SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018135 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018135
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 178-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000295
Family EGF-type module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018135   Gene: ENSPANG00000016903   Transcript: ENSPANT00000026944
Sequence length 640
Comment pep:known_by_projection chromosome:PapAnu2.0:8:30640984:30856416:1 gene:ENSPANG00000016903 transcript:ENSPANT00000026944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRISKASLADSGEYMCKVISKLGN
DSASANITIVDSNEIITGMPASTEGAYMSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESILSESHSVIMMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFVEEERPLLL
VTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPPSPLRIVEDEEYETTQEYEPAQEPVKK
LANSRRAKRTKPNGHIANRLEVDGNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLE
ATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
Download sequence
Identical sequences A0A2K5MWN5 A0A2K5TYQ0 A0A2K5YYS5 A0A2K6D681
XP_005563080.1.63531 XP_011731012.1.29376 XP_011833095.1.47321 XP_011900931.1.92194 ENSPANP00000018135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]