SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018211 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018211
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily EF-hand 3.49e-28
Family Calmodulin-like 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018211   Gene: ENSPANG00000014555   Transcript: ENSPANT00000019351
Sequence length 185
Comment pep:known_by_projection chromosome:PapAnu2.0:13:25601128:25659766:-1 gene:ENSPANG00000014555 transcript:ENSPANT00000019351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPA
LRVNPFRDRICRVFSHKGVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEE
DLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDDDNMLSFSEFEHAMAKSPDFMNSFRI
HFWGC
Download sequence
Identical sequences A0A096NYP8
ENSPANP00000018211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]