SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018509 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018509
Domain Number 1 Region: 368-534,590-743
Classification Level Classification E-value
Superfamily L domain-like 8.11e-46
Family Ngr ectodomain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 1012-1201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-41
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 140-346
Classification Level Classification E-value
Superfamily L domain-like 1.91e-41
Family Ngr ectodomain-like 0.00025
Further Details:      
 
Domain Number 4 Region: 1-109
Classification Level Classification E-value
Superfamily L domain-like 8.16e-27
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 5 Region: 863-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000762
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 783-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000195
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 940-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 826-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000986
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 905-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1197-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000228
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018509
Domain Number - Region: 1288-1316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1240-1277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000473
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018509   Gene: ENSPANG00000007747   Transcript: ENSPANT00000005021
Sequence length 1397
Comment pep:known_by_projection chromosome:PapAnu2.0:5:15241134:15392535:1 gene:ENSPANG00000007747 transcript:ENSPANT00000005021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSV
ASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQK
REFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTI
KVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLF
SLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPF
ICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDY
RSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATG
IFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLM
LRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYL
AWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECT
CLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTL
SNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISAVPEGAFNDLSALS
HLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVD
VNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTC
HLKEGEEDGFWCICADGFEGENCELNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGEL
CEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNKCKNGAHCT
DAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIVRINEPICQCLPGYQ
GEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDHIAVELYR
GRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGSPKIITNLSKQST
LNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVAMQTGILPG
CEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFS
YSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREIS
CRGERIRDYYQKQQGYAACQTAKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSF
VDEVEKVVKCGCTRCAS
Download sequence
Identical sequences ENSPANP00000018509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]