SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018674 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018674
Domain Number 1 Region: 11-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-114
Family Calpain large subunit, catalytic domain (domain II) 0.000000102
Further Details:      
 
Domain Number 2 Region: 351-499
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.09e-38
Family Calpain large subunit, middle domain (domain III) 0.000075
Further Details:      
 
Domain Number 3 Region: 517-683
Classification Level Classification E-value
Superfamily EF-hand 3.69e-27
Family Penta-EF-hand proteins 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018674   Gene: ENSPANG00000000711   Transcript: ENSPANT00000014411
Sequence length 687
Comment pep:known_by_projection chromosome:PapAnu2.0:13:30219945:30248871:-1 gene:ENSPANG00000000711 transcript:ENSPANT00000014411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWPPFRCRWKLGPRYSRRASPQLPQQDFEALLAACLRNGCLFEDTSFPATLSSIGSGS
LLQKLPPRLQWKRPPELHSNPQFYFAKTKRLDLCQGMVGDCWFLAALQALTLHQDILSRV
VPLNQSFTEKYAGIFRFWFWHYGKWVPVVIDDRLPVNEAGQLLFVSSTYKNLFWGALLEK
AYAKLSGSYEDLQSGQVSEALVDFTGGVTMTINLAEAHGNLWDILTKATYNRRRKLTIIK
CQLHKEKILENGLVEGHAYTVTGIRKVTCKHRPEYLVKLRNPWGQVEWKGDWSDSSSKWE
LLSPKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTYTMREGRW
EKGSTAGGQRQLLQGTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPH
LAIGFYLYRVNKYYDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCT
SEANQKSEFILRVFSRKHIFYEIGSNSGVVFSKEIEDQNEGQDELFTKFFEKYPEINAVQ
LQSILNQMTWSHLGSRQPFFSLEACQGILALLDLNASGTMSIQEFRDLWKQLKLYQKVFH
KQDNGSGYLNWEQLRAAMKEAGIVLSDDVCQLMLVRYGCPRLQMGFVSFVHLMLRVENME
DVFQNLTQDGKGIYLQKPEWMMMALYS
Download sequence
Identical sequences ENSPANP00000018674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]