SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018819 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018819
Domain Number 1 Region: 353-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 2 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 3 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 456-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000475
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018819
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000206
Family Sialidases (neuraminidases) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018819   Gene: ENSPANG00000025992   Transcript: ENSPANT00000028432
Sequence length 525
Comment pep:known_by_projection chromosome:PapAnu2.0:15:5725643:5802894:-1 gene:ENSPANG00000025992 transcript:ENSPANT00000028432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGNCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRG
YTGVRCEQPRCDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLA
Download sequence
Identical sequences ENSPANP00000018819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]