SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018830 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018830
Domain Number 1 Region: 36-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000173
Family Laminin-type module 0.00033
Further Details:      
 
Domain Number 2 Region: 92-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family Laminin-type module 0.00085
Further Details:      
 
Domain Number 3 Region: 143-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 191-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000339
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018830
Domain Number - Region: 7-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family Laminin-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018830   Gene: ENSPANG00000025978   Transcript: ENSPANT00000028395
Sequence length 801
Comment pep:known_by_projection chromosome:PapAnu2.0:15:6898685:6926875:-1 gene:ENSPANG00000025978 transcript:ENSPANT00000028395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHVLPLHTGRRCEVCDDGFFGDPLGLSGPPQPCYQCQCSGNVDPNAVGNCDPLSGHCLRC
LHNTAGYHCEHCREGFYGSALVPRPADKCKPCSCHPQGSVSEQMPCDPVTGQCSCLPHVT
GRDCSRCYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGF
FGFSIKGCRACRCSPLGAASAQCHENGTCICRPGFEGYKCDRCHDNFFLTADGTHCQECP
SCYALVKEEAAKLKAKLTLMEGWLQGSNCGSPWGPLDILLGEAPRGDIYQGHHLLPGVRE
AFLEQMMGLEGAVKASREQLQRLSKGAHCAQAGAQKTCTQLADLEAVLESSEEEILHAAA
ILASLEIPQDGPGQPTKWSHLATEARALARSHRDTATKIAATAQRALLASNTSYALLWSL
LEGRMALETQRDLEDRYQEVQAAQKALGTAMAEVLPEAESVLAAVQQVGADTAPYLALLA
SPGALPQKSWAEDLSLKAKILEKTVASQQHMATKAARTLHAAAQAALRQTEPLTQLHQEA
RTALTQASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVRDRLLADMR
KKTTQAERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLREGNQVHRRASQLTSQTQ
ATLQQASRQVLDSEARRQELEEAEQVGAGLSEMEQQIRESRISLEKDIEALSELLARLGS
LDTHQAPAQALNETQWALERLRLQLDSPGALQRKLRLLEQESEQQELQIQGFESDLAEIR
ADKQNLEAILHSLPENCASWQ
Download sequence
Identical sequences ENSPANP00000018830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]