SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018837 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018837
Domain Number 1 Region: 2183-2398
Classification Level Classification E-value
Superfamily GFP-like 1.26e-60
Family Domain G2 of nidogen-1 0.0018
Further Details:      
 
Domain Number 2 Region: 2094-2185
Classification Level Classification E-value
Superfamily Immunoglobulin 7.76e-24
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 823-907
Classification Level Classification E-value
Superfamily Immunoglobulin 7.39e-23
Family I set domains 0.0055
Further Details:      
 
Domain Number 4 Region: 428-514
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-22
Family I set domains 0.0091
Further Details:      
 
Domain Number 5 Region: 1459-1552
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 1822-1919
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-22
Family I set domains 0.0084
Further Details:      
 
Domain Number 7 Region: 714-812
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 633-720
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-22
Family I set domains 0.0065
Further Details:      
 
Domain Number 9 Region: 993-1094
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 223-320
Classification Level Classification E-value
Superfamily Immunoglobulin 1.77e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 329-416
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 12 Region: 1107-1187
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 13 Region: 1739-1827
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-20
Family I set domains 0.0099
Further Details:      
 
Domain Number 14 Region: 900-999
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 15 Region: 1270-1369
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-20
Family I set domains 0.026
Further Details:      
 
Domain Number 16 Region: 1184-1277
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 17 Region: 139-227
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 18 Region: 542-625
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 19 Region: 2016-2101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 20 Region: 1905-2004
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-19
Family I set domains 0.023
Further Details:      
 
Domain Number 21 Region: 46-134
Classification Level Classification E-value
Superfamily Immunoglobulin 8.02e-19
Family I set domains 0.0062
Further Details:      
 
Domain Number 22 Region: 1641-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 4.17e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 23 Region: 1546-1645
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-17
Family I set domains 0.008
Further Details:      
 
Domain Number 24 Region: 1357-1456
Classification Level Classification E-value
Superfamily Immunoglobulin 7.12e-17
Family I set domains 0.038
Further Details:      
 
Domain Number 25 Region: 2405-2540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.8e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 26 Region: 2641-2749
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 27 Region: 2544-2589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000257
Family EGF-type module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018837   Gene: ENSPANG00000025970   Transcript: ENSPANT00000028391
Sequence length 2852
Comment pep:novel chromosome:PapAnu2.0:15:7533118:7600183:-1 gene:ENSPANG00000025970 transcript:ENSPANT00000028391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGEGVSLRGLGQVCGAWWPQQLSLMGFLPIPTVPPQIAGPQELPTQVSVVQDGVTTLE
CNATGKPPPTVTWEQDGQPVGAELGLQLQNQGQSLRVERARAAHAGRYSCVAENLAGRAE
RRFELSVLVPPELIGDLDPLTNITAALHSPLTLLCEATGIPPPAIRWFRGEEPVSPGEDT
YLLAGGWMLKMTQTQEQDRGLYSCLASNEAGEARRNFSVEVLVPPSIENEDLEEVIKVPE
GQTAHLMCNVTGHPQPKLTWFKDGRPLAGGDAHHISPDGVLLQVLQANLSSAGHYSCIAA
NAVGEKTKHFQLSVLLAPTILGVAEDSADEEVTVTIHNPISLICEALAFPSPSITWMKDG
APFEASRNIQLLPGTHGLQILNAQKEDAGQYTCVVTNELGEAVKNYHVEVLIPPSISKDD
PLGAVGVKEVKTKVNSTLTLECESWAAPPPTIHWYKDGQPVTPSPRLHVLGEGRLLQIQP
TQVSDSGRYLCVATNVAGEDDQDFNVLIQVPPMFQKVGDASAAFEILSREQEARGGVTEY
REIVENNPAYLYCDTNAIPPPELTWYKEDRPLSAGDGVSVLQGGRVLQIPLVRAEDAGKY
SCKASNEVGEDWLHYELLVLTPPVILGATEELVEEVTVNASSTVSLQCPALGNPVPTISW
LQNGLPVSPSPRLQVLEDGQVLQVSTAEVADAASYMCVAENQAGSAEKLFTLRVQVPPRI
AGLDLEQVTAILNSSVSLPCDVHAHPNPEVTWYKDSQALSLGEEIFLLPGTHTLQLGRAR
LSDSGTYICEALNAAGRDQKLVQLSVLVPPAFRQAPSGPHGAVLVRVGNRAVLSCETDAL
PEPTVTWYKDGQPLVLAQRTQALQGGQRLEIQEAQVSHKGLYSCKVSNVAGEAVRTFTLT
VQVPPTFENPKTETVSQVAGSPLVLTCDVSGIPAPTVTWLKDRMPVESSVVHGVVSRGGR
LQLSRLQPTQAGTYTCVAENTQAEARKDFVVAVLVAPRIRSSGTAQEHHILEGQEVRLDC
EADGQPLPDVAWLKDGSPLGQDMGPHLRFYLDGGSLVLKGLRASDAGAYTCVAHNPAGED
ARLHTVNVLVPPTIEQGADGSGALVSRPGELVTMACPVRGSPPIHVSWLKDGLPLPLSQR
TLLHGSGRTLRISQVQLADAGIFTCVAASPAGVADRNFTLQVQVPPVLEPVEFQNEVMVV
RGSPVELPCEARGVPLPLVSWMKDGEPLLSQSLEQGPSLQLETVGAGDSGTYSCVAVSEA
GEARRHFQLTVVEPPHIEDSGQPTELSLTPGAPMELLCEAQGTPQPNITWHKDGQALTRL
ENNSRATRVLQVESVQVGDAGLYTCLAESPAGAVEKSFRVRVQAPPNIVGPRGPRFVVGL
APGQLVLECSVEAEPAPEITWHRDGIVLQEDAHTQFPERGRFLQLQALSTADSGDYSCTA
RNAAGSTSVAFHVEIHTVPTIRSGPPAVNVSVNQTALLPCQADGVPTPLVSWRKDGVPLD
PRSPRFEVLPEGSLRIQPVLAQDAGHYLCLVSNSAGSDRQGRDLRVFEPPAIAPSPSNLT
LTAHTPASLPCEASGSPKPLVVWWKDGQKLDFRLQQGAYRLLPSNALLLAAPGPQDSAQF
ECVVSNEVGEARRLYQVTVHVPPTIADDQTDFTVTMMAPVVLTCHSTGVPAPTVSWSKAG
AQLGARGSGYRVSPSGALEIGQALPIHAGRYTCSARNSAGVAHKHVFLTVQASPVVKPLP
SVVRAVAEEEVLLPCEASGIPRPIITWQKEGLNIPAGVSTQVLPGGQLRIAHASLEDAGN
YLCIAKNSAGSAMGKTRLVVQVPPVIENGLPDLSTTEGSHAFLPCKARGSPEPNITWDKD
GQPVSGAEGKFTIQPSGELLVKNLEGRDAGTYTCTAENAVGRARRRVHLTILALPVFTTL
PGDRSLRLGDRLWLRCAARGSPTPRIGWTVNDRPVTEGVSEQDGGSTLQRASVSREDGGT
YVCWAENRVGRTQAVSFVHVKEAPVLQGEAFSYLVEPVGGSIQLDCVARGDPVPAIRWIK
DGLPLRGSRLRHQLRNGSLTIRSTERDDAGQYQCLAENEMGMAKKVVILVLQSAPVFQVE
PQDMTVRSGDDVALRCQATGEPIPTIEWLRAGQPLRASRRLRTLPDGSLWLENVETGDAG
TYDCVAHNLLGSATARAFLVVRGEPQGSWGSMIGVINGRKFGVARLNTSVMQEVRSGVSS
IRSSIHHVPANVGPLMRVLLVTIAPIYWALARESGEALNGHSLTGGRFRQESHVEFATGE
LLTMTQVARGLDPDGLLLLDVVVNGVVPESLADADLQVQDFEERYVQTGPGQLFVDSTQH
FFQGSLPSFLRCNHSIQYNAARGPQPQLVQHLRASAISSAFDPEAEALRFQLTTALQAEE
NKVGCPEGFELDSQGAFCVDRDECSGGPSPCSHTCLNAPGRFSCACPAGFALAWDDRNCR
DVDECAGDARLCREGQRCVNLLGSYRCLPDCGPGFRVAADGASCEDVDECLEGLDDCHYN
QLCENTPGGHRCSCPRGYRMQGPSLPCLDVNECLQLPKACAYQCHNLQGSYRCLCPPGQT
LLRDGKACTSLERNGQNVTAVSHRGPLVPWLRPRASIPGGSYHAWVSLRPGPVALSSVGR
AWCPPGFIRQNGVCTDLDECRVRNLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINEC
EEEDIECGPGQMCFNTRGSYQCVDTPCPATYRQGPSPGTCFRRCSQDCGTGGPSTLQYRL
LPLPLGVRAHHDVARLAAFSEAGVPANRTELSVLEPDPRSPFALRPLRAGLGAVYTRRAL
TRSGLYRLTVRAAAPRHQSVFVLLIAVSPYPY
Download sequence
Identical sequences ENSPANP00000018837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]