SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018873 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018873
Domain Number 1 Region: 1265-1399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-19
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 2 Region: 250-388
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 1188-1258
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.0000932
Further Details:      
 
Domain Number 4 Region: 1071-1192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-18
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 5 Region: 89-155
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-17
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 6 Region: 663-736
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-17
Family TB module/8-cys domain 0.0000592
Further Details:      
 
Domain Number 7 Region: 1471-1541
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-17
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 8 Region: 823-889
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.63e-16
Family TB module/8-cys domain 0.00059
Further Details:      
 
Domain Number 9 Region: 985-1110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000135
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 500-634
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000126
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 11 Region: 376-513
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 12 Region: 742-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000904
Family EGF-type module 0.00077
Further Details:      
 
Domain Number 13 Region: 1-70
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000392
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 14 Region: 902-1027
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 15 Region: 620-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.00056
Further Details:      
 
Domain Number 16 Region: 165-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 17 Region: 1427-1475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000107
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 18 Region: 208-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.001
Further Details:      
 
Domain Number 19 Region: 1386-1423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018873   Gene: ENSPANG00000025901   Transcript: ENSPANT00000028072
Sequence length 1548
Comment pep:novel scaffold:PapAnu2.0:JH687013.1:150342:210899:1 gene:ENSPANG00000025901 transcript:ENSPANT00000028072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQHQLTGLACTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPSTATLNQTIDICRHFTN
LCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVRLEPCFLRWDEDECGVTLPGKYRMDVC
CCSIGAAWGAECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKAFPGLCTH
GTCRNMVGSFHCACAGGFALDAQEWNCTDIDECRISPDLCGQGACVNTPGSFECECFPGY
ESGFMLMKDCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAEGTACEDIDECSL
RDGLCPHGHCVNVIGAFQCSCHAGFQGTPDHQGCVDINECRVRNGGCDVYCINTEGSYRC
SCRQGYSLMPDGRACADVDECEENPSICDQGHCTNVLGGHRCLCYDGFVATPDMRTCVDV
DECDLNPHICLHGDCENTKGSFVCHCQLGYMIRKGATGCSDVDECEVGGHNCDSHAFCLN
IPGSFSCRCLPGWEGHGFECHDLDECVSQEHQCSPKGDCLNVPGSYRCTCRQGFTGDGFS
CEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTKDHRACQDVDECAQGNLCAFGSC
ENLPGMFRCICDGGYELDRGGGNCTDINECADPVNCINGVCVNTPGSYLCRCPQDFELNP
SGVGCVDTRAGNCFLETHDRGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPVANT
TEYRTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGDCINTFGSFQCECPPGYHLSEH
TRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNG
TCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPTSPDYQILCGNQAPGFLIDIHTRKP
LDIDECGEIPAICASGVCINQIGSFRCECPTGFNYNSILLACEDVDECGSRESPCQQNAD
CINIPGSYRCECTRGYKLSPGGACVGRNECREISNVCSHGDCMDTEGSYMCLCHRGFQAS
ADHTLCMDIDECDQQPCGNGTCKNIIGSYNCLCFSGFVVTHNGDCVDFDECTTLVGQVCL
FGHCLNTAGSFHCLCQDGFELTTDGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPG
FQVQSDHCIDIDECSDEPNLCLFGSCSNSPGSFQCLCPPGFVLSDNEHRCFDTRKSFCFT
RFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPD
DSREDVNECAENPGVCTNGICVNTDGSFRCECPLGYSLDFTGINCVDTDECSVGHPCGQG
TCTNVIGGFECACADGFEPGPMMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLR
EDGAMCRDVDECADGQQDCHAQGMECKNLIGTFVCICPPGMRPLPGSGEGCTDDDECRAQ
PDLCVNGHCVNTEGSFRCDCDEGFQPSPTRTECHDIRQGPCFAEVLQAMCQALSSSSEAV
TRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRGGCPC
Download sequence
Identical sequences ENSPANP00000018873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]