SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018935 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018935
Domain Number 1 Region: 399-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 204-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 3 Region: 254-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000343
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 303-450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018935   Gene: ENSPANG00000025814   Transcript: ENSPANT00000027634
Sequence length 601
Comment pep:known_by_projection chromosome:PapAnu2.0:15:14068569:14180010:1 gene:ENSPANG00000025814 transcript:ENSPANT00000027634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGAERAMRSLPSLGGLALLCCAAAAAASAASAGNVTGGSGAAGQVDASPGPGLRGEPS
HPFPRATAPTAQAPRTGPLRATVHRPLAATSPAQSPETTPPRATARPASTTFQTPLGPSP
TTPPAAERASTTSQAPTRPPPTTLSTITGPVPTTPVATTVPAPTTPRTSTPDLPSSSSSS
SRSSVPPTPPATEAPSSPSPEYVCNCSVVGSLDVNHCNQTTGQCECRPGYQGLHCETCKE
GFYPNYTSGLCQPCDCSPHGALSILCNSSGKCQCKVGVIGSTCDRCQDGYYGFSKNGCLP
CQCNNRSASCDALTGACLNCQNSKGNHCEECKEGFYQSPDATKECLRCPCSAVTSTGSCS
IKSSELEPECDQCKDGYMGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGE
CINCLHNTTGFWCENCLEGYVQDLEGNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVIN
STFTPTTLQTVFSVSTSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREY
QNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYK
A
Download sequence
Identical sequences A0A096P0R0
ENSPANP00000018935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]