SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018936 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018936
Domain Number 1 Region: 378-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 183-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 3 Region: 233-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 282-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018936   Gene: ENSPANG00000025814   Transcript: ENSPANT00000027635
Sequence length 580
Comment pep:known_by_projection chromosome:PapAnu2.0:15:14068569:14180010:1 gene:ENSPANG00000025814 transcript:ENSPANT00000027635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGAERAMRSLPSLGGLALLCSAGNVTGGSGAAGQVDASPGPGLRGEPSHPFPRATAPT
AQAPRTGPLRATVHRPLAATSPAQSPETTPPRATARPASTTFQTPLGPSPTTPPAAERAS
TTSQAPTRPPPTTLSTITGPVPTTPVATTVPAPTTPRTSTPDLVPPTPPATEAPSSPSPE
YVCNCSVVGSLDVNHCNQTTGQCECRPGYQGLHCETCKEGFYPNYTSGLCQPCDCSPHGA
LSILCNSSGKCQCKVGVIGSTCDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQ
NSKGNHCEECKEGFYQSPDATKECLRCPCSAVTSTGSCSIKSSELEPECDQCKDGYMGPN
CNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENCLEGYV
QDLEGNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTVFSVSTSENST
SALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNISF
SSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences ENSPANP00000018936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]