SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018974 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018974
Domain Number 1 Region: 88-207
Classification Level Classification E-value
Superfamily PX domain 1.44e-31
Family PX domain 0.00064
Further Details:      
 
Domain Number 2 Region: 263-434
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000698
Family IMD domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018974   Gene: ENSPANG00000025767   Transcript: ENSPANT00000027397
Sequence length 458
Comment pep:known_by_projection chromosome:PapAnu2.0:15:21842562:21966932:-1 gene:ENSPANG00000025767 transcript:ENSPANT00000027397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGPPKALPSTGPHSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGG
TPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETYITYRITTKSTRV
EFDLPEYSVRRRYQDFDWLRSKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKAL
DKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGIALLTRMGESVKHVTGGYKLRTRPL
EFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEG
VSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAEYEAKLEAVAL
RKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCL
MAWESIIPLLQEKQEAKPNLPSSTSSTSAPIWGDEETS
Download sequence
Identical sequences ENSPANP00000018974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]