SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018983 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018983
Domain Number 1 Region: 180-250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000082
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 240-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000113
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 3 Region: 127-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000267
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 4 Region: 39-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000439
Family Growth factor receptor domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018983
Domain Number - Region: 429-460
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.0761
Family Glycosyl hydrolases family 32 N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018983   Gene: ENSPANG00000025758   Transcript: ENSPANT00000027374
Sequence length 771
Comment pep:known_by_projection chromosome:PapAnu2.0:15:22539097:22674497:1 gene:ENSPANG00000025758 transcript:ENSPANT00000027374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGPRGAGPPRRLLPLLLLLGLARGAAGAPGADGLDVCATCHEHATCQQREGKKICICN
YGFVGNGRTQCVDKNECQFGATVVCGNHTSCHNTPGGFYCICLEGYRATNNNKTFIPNDG
TFCTGSQDVDECEVSGLCRHGGRCVNTHGSFECYCMDGYLPRNGPEPFHPTTDATSCTEI
DCGTPPEVPNGYIIGNYTSRLGSQVRYACREGFFSVPEDTVSSCTALGTWESPKLHCQEI
NCGNPPEMRHAILVGNHSSRLGGVARYVCQEGFESPGGKITSVCTEKGTWRESTLTCTEI
LTKIDDVSVFNDTCVRWQINSGRINPKIAYVISIKGQRLDPMESVHEETVNLTTDSRTPE
VCLALYPGTNYTVNISTAPPRRSVPAVIGFQTAEDDLLEDDGIFNISIFNETCLQLNRHS
RKVGSEHMYQFTVLGQRWYLDNFCHATSFNFTTWERAPVVCLDLYPATDYAVNVTLLGSP
KGHSVQITIATPPAVKQTISNISGFNETCLRWRSIKTADMEEMYLVTSWGTWQSHRFSHE
ALFLPNSSSQTLEDGHCTVGLPGTYSYNLRRRIKPSNLPISYRLYSMFSEPPLPEVEFFT
VHGGPLPRLRLRKAKEKNGPISSYQVLVLPLALQSTFSCDSEGTSSFFSNASDADGYVAA
ELLAKDVPDDAMEILIGDRLYYGEYYNAPLKRGNDYCIILRITSEWNKVRRHSCAVWAQV
KEIPCNCNFLRLHIHRANSGDTQARWAFLGFFIRHSHCCRWRVLDWAPWLL
Download sequence
Identical sequences ENSPANP00000018983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]