SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019005 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019005
Domain Number 1 Region: 68-277
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.26e-70
Family alpha-catenin/vinculin 0.00041
Further Details:      
 
Domain Number 2 Region: 392-524
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.26e-36
Family alpha-catenin/vinculin 0.0018
Further Details:      
 
Domain Number 3 Region: 556-629
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.73e-19
Family alpha-catenin/vinculin 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019005
Domain Number - Region: 291-396
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0157
Family FAT domain of focal adhesion kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019005   Gene: ENSPANG00000025732   Transcript: ENSPANT00000027300
Sequence length 636
Comment pep:known_by_projection chromosome:PapAnu2.0:15:25801128:25869874:1 gene:ENSPANG00000025732 transcript:ENSPANT00000027300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPGPAGVGGAGAVYGSGPLGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKK
SDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDI
TNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMER
LEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLT
ASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSVSIFTGIKEFK
MNIEALRENLYFQSKENLSVTLEVILERTEDFTDSAYTSHEHRERILELSTQARMELQQL
ISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKA
LKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPMEITCIHAEETFQVTGQQ
IISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREISDVFEGRRGEKYGYLSLP
KPMKNNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM
SSMAYSLYLFTRGEGPLKTSQDLIHQLEVCLVSLLC
Download sequence
Identical sequences A0A096P0Y0
ENSPANP00000019005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]