SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019090 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000019090
Domain Number - Region: 636-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019090   Gene: ENSPANG00000025485   Transcript: ENSPANT00000026715
Sequence length 924
Comment pep:known_by_projection chromosome:PapAnu2.0:15:40162362:40186937:-1 gene:ENSPANG00000025485 transcript:ENSPANT00000026715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPLSRPLVLSRSPPWPPVPPSPRFPNRPQPLPGSPSRTPFQSLPLAWPPSRPQPSFHP
LSQISAQGLSQPHSQCLLKALAQPRPLLQSPSQPLLPSHSLPLFKPQCPAQPNPLSQLLP
SSLCLPKSLPLVPPISYTLPLSQPRLKSGFQLPPALLLLLLFSVLGPGAGGLFLTDYSTC
SPRKLSPFRSFASTELFHFHVPEDTFLAVWNLIIFKEQGGTFGDHCPDQSVTVYFRSGAP
PVINPLHTHFPGDTAVPGVFSLTLSWTLPNRTSGIFNVSSPLPGDWFLAAHLPQAHGHIS
VKGLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQTLSPHNRSALYKVFVPSFTYRVSAQ
LACVGGRGVSACPLSLRLRPKAPPLHNSSSVSCGGASGCQLELALPPWGHWVYVRVETSS
RGPGRTIRFQLCVRLQECPQPGLLRALVPGAAMNMPQSLGNQPLPPEPPSLGTPAEGPGT
TSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLE
LQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLVSVSATTRVARLRIPFP
QTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAA
CECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFT
MFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLG
AMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSL
IAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDHRVPSGARARGCGYQL
CINEQEELGLVGPGGATVSSICAS
Download sequence
Identical sequences A0A096P165
ENSPANP00000019090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]