SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019110 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019110
Domain Number 1 Region: 1436-1505
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000564
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 2 Region: 995-1170
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000157
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019110   Gene: ENSPANG00000025353   Transcript: ENSPANT00000026553
Sequence length 1515
Comment pep:known_by_projection chromosome:PapAnu2.0:15:40459900:40482337:-1 gene:ENSPANG00000025353 transcript:ENSPANT00000026553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGAGGGSGSTRPNPFCPPELGITQPDQDLG
QADSLLFSSLHSAPGGTARSIDSTKSRSRDGRGPGAPKRHNPFLLQEGVGEPGLGDLYDD
SIGDSATQQSFHLHGTGQPTFHLSSFQLPPSGPRVGRPWGATRSRAGVVEGQEQEPVMTL
DTQQCSASHCCRPELEADTMELDECGGPGGSGSGGGASDTSGFSFDQEWKLSSDESPRNP
GCSGSGAQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHGTPRANLN
SAPQSCSDSSFCSHSDPGAFYLDLQPSPAESKMSYESHHPESGGREGGYGCPHASSPELD
ANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSC
SEEHTKISPPPGPGPDPGPSQPSEYYLFQKPEVQPEEQEAVSSSSEAAAAVGPTVLEGQV
YTNTSPPNLSTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPAAIAGPSSPPRR
VTSFAELAKGRKKTGGSGSPPLRVSVGDSSQEFSPIQEAQQDRGAPLDEGTRCSHSLPPM
PLGPGMDLLGPKPSPPWSTQVCQGPHSSEMPPAGLRAAGQGPLAQLMDPGTALPGSPANS
HTQRDARARADGGGTESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHSLSQLY
SLSGCSRTQQPAPLAAPAAQVSVPAPSGEPQASTLRATGRGARKAGSEPETSRPSPLGSY
SPIRSVGPFGPSTDSSASTSCSPPPEQPTATESLPPWSHSCPPAVRPATSQQPQKEDQKI
LTLTEYRLHGTGSLPPLGSWRSGLSRAESLARGGGEGSMATRPSNANHLSPQALKWREYR
RKNPLGPPGLSGILDRRSQEARLARRNPIFEFPGSLSAASHLNCRLNGQAVKPFPLTCPD
FQDPFSLTEKPPAEFCLSPDGSSEAISIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGVK
AKLGNSSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGP
STKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWG
FLSAAHTVCPSLFEELLLLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLLL
SAHSTLQLARARGQEGPGDMDRAAQGERVKGVGASEGGEEEEEEETEEVAEAAGGSGRGR
WARGGQAGWWYQLMQSSQVYIDGSTEGSRFPRGSSNSSSEKKKGAGGGGPPQAPPPREGV
VEGAEACPASEEALGRERGWPFWMGSPPDSVLAELRRSREREGPAAPPAENEEGASEPSP
GGIKWGHLFGSRKAQREARPTNRLPSDWLSLDKSMFQLVAQTVGARREPEPKESLQEPHS
PALPSSPPCEVQALCHHLATGPGQLSFHKGDILRVLGQAGGDWLRCSRGPDSGLVPLAYV
TLTPTPSPTPGSSQN
Download sequence
Identical sequences A0A096P185
ENSPANP00000019110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]