SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019446 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019446
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000277
Family Glutathione peroxidase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019446   Gene: ENSPANG00000024638   Transcript: ENSPANT00000024358
Sequence length 226
Comment pep:known_by_projection chromosome:PapAnu2.0:15:105793836:105808010:-1 gene:ENSPANG00000024638 transcript:ENSPANT00000024358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAPVTRQVSGGTVPVPAPSGPDRGQPLAAAVAELPVLDARGQRVPFGALFRERRAVV
VFVRHFLCYICKEYVEDLAKIPKSFLQEANVTLIVIGQSSYHHIEPFCRLTGYSHEIYVD
PEREIYKRLGMKRGEEIASSGQSPHVKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGIL
ILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV
Download sequence
Identical sequences A0A096P271
ENSPANP00000019446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]