SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019547 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019547
Domain Number 1 Region: 281-467,537-584
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.61e-39
Family Phospholipase D 0.069
Further Details:      
 
Domain Number 2 Region: 599-794
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.34e-27
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 62-195
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000785
Family PX domain 0.0084
Further Details:      
 
Domain Number 4 Region: 229-308
Classification Level Classification E-value
Superfamily PH domain-like 0.000000201
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019547   Gene: ENSPANG00000024330   Transcript: ENSPANT00000023637
Sequence length 933
Comment pep:known_by_projection chromosome:PapAnu2.0:16:4495752:4512620:1 gene:ENSPANG00000024330 transcript:ENSPANT00000023637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATPESLFPTGDELDSSQLQMESDEVDTLREGEDPADRMHPFLAIYELQPLKVHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPAQDAANREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHALTEFLEVSQLSFIPDLGCKGLEGTIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELARGPGRDFLQLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAASQPPTPCPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIKESRHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGVEYQAGRFALSLRKHCFSVILGANTRPDLDLRDPVCD
DFFQLWQDTAESNANIYEQIFRCLPTNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
Download sequence
Identical sequences A0A096P2H2
ENSPANP00000019547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]