SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019578 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019578
Domain Number 1 Region: 715-972
Classification Level Classification E-value
Superfamily RNI-like 5.1e-48
Family 28-residue LRR 0.0000439
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 4.24e-18
Family Pyrin domain, PYD 0.0000101
Further Details:      
 
Domain Number 3 Region: 1376-1462
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-17
Family Caspase recruitment domain, CARD 0.017
Further Details:      
 
Domain Number 4 Region: 318-419,454-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000464
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019578   Gene: ENSPANG00000024299   Transcript: ENSPANT00000023449
Sequence length 1473
Comment pep:known_by_projection chromosome:PapAnu2.0:16:5192699:5247464:-1 gene:ENSPANG00000024299 transcript:ENSPANT00000023449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGAWGRLACYLELLKKEELKEFQLLFASKVHSSGSSGETPARPEKTSGMEVASYLVAQ
YGEQRAWDLALRTWEQMGLWSLCTQAWEGAGYSPSFPYSPSEPHLGSPSQPTSTAVLRPW
NRELPGECTQGSERRVLRQLPDTSGRRWREISSSLLYQAFPSSPDFESPSQESPNAPTST
AVLASWGSPPQPSLAPREQEAPGTQWPLDETSGNYYTGVTQHIRGTTEQGRPPWEAAVGM
PPLVHTSLQPHHHPWEPSARESLCSTWSWKNEDLNQNFTQLLLLQRPHPRNHKPLVKGSW
PHDAEEDVEEDRGRLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVREAWGRGQL
YGDRFQHVFYLSCRELAQCEAVSLAELIGKDWTAAQAPIRQILSRPERLLFILDGVDEPR
WVLQESSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWV
EVLGFSESSRREYFYKYFTDERQAIRALGLIKSNKELWALCLVPWVSWLTAPADEQMKRR
RTHTDLQDHTTLCLHYLSQALQAQPLGPQLGDVCSLAAESIWQKKTLFSRDDLRKHELDG
AIISTLLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYALDKKGRGKHANCIIDLEKLLEA
YGTHGLFGAPTTRFLLGLLSDEGKRAMENIFNCRLSQGRNLMQWVPSLRPLLQPHSLDFL
HCLYETQNKTFLTQMMADFQEMGMCVETDMELLVCTFCIQFCRHVKKLQLIEGRQHRPAW
SPTGIVLFRWVPVTDGYWEILFSILKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLL
ETLRLASCGLTAEDCKGLASGLRVNQNLTLLDLSFNVLTDAGARHLCQRLSWPRCTLQRL
QLVSCGLTSGCCQDLASVLSASPFLMELDLQQNNLGDTGVRLLCEGLRHPACQLTRLGLD
QMTLSDEMRQELRALEQKKPQLLIFSRWKPTGMIPDEGLGTGETSNSTSSLKRQRLGSVH
LLNHVPLSTCPPGHAGKCGTSVPVGKGSSPEVEQVEPLCLPSPASLGDQDTPLGTDDDFW
GPTGPVATEVVDKERSLYRVHFPVAGSYRWPNTGLCFVVREAVTTEIEFCVWDQFLGEIN
PQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQVAHFKEEGMLLEKPARV
ELHHIILENPSFSPLGVLLKVIHSTLRFFPVNSLVLLYHRLHPEEVTFHLYLIPSDCSIR
KAIDDEETKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEAQLF
SEFYVGHLGSGIRLQMKDKKDETLVWEALVKPGDLTPAATLVPPAPIALPSSLDAPGLLH
FVDQYREQLIARVTSVEAVLDKLYGQVLSQEQYERVLAEDTRPSQMRKLFSLSQSWDRRC
KDQLYQALKETHPHLIMELWEKGSKKGVLPLSS
Download sequence
Identical sequences ENSPANP00000019578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]