SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019694 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019694
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 2.78e-44
Family Calmodulin-like 0.0000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019694   Gene: ENSPANG00000023754   Transcript: ENSPANT00000022908
Sequence length 200
Comment pep:known_by_projection chromosome:PapAnu2.0:16:9563088:9573460:-1 gene:ENSPANG00000023754 transcript:ENSPANT00000022908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSKSGALSKEILEELQLNTKFSEEELSSWYQSFLRDCPSGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPEDENTPEKRAEKIWKYFGKRDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKIKNA
Download sequence
Identical sequences A0A096P2W9
ENSPANP00000019694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]