SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019761 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019761
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 391-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 335-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 297-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000232
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 253-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000736
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 429-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000323
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 127-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000234
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019761
Domain Number - Region: 186-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000141
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019761   Gene: ENSPANG00000023672   Transcript: ENSPANT00000022333
Sequence length 482
Comment pep:novel scaffold:PapAnu2.0:JH686544.1:20396:24096:1 gene:ENSPANG00000023672 transcript:ENSPANT00000022333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVVFQGSVSFKDVTVGFTQEEWQHLDPAQRTLSRDVMLENYSHFVSVGYCIPKPEVILKL
EKGEEPWILEEKFPFQSHLGELVSARWIIILKKFAKFNKGGKCFCDESEIIHFEEEPYEY
NKNGNGFWLNEDLVWHQKIKNCEQPFEYNKYGNAFTENSLFLVCKRAYTGQKACKYTEHG
KTCDVSFFITHQQTHPRENHYECKEYGESIFEESILLEHQSVYPFSQRLNLTPIQRTHSI
NNIIKYNECGTFFSEKLVLHLQHRTYTGEKPYECHEYGKTFTQKSAHTRHQKTHTGKPYE
CHECVKTFCKNSDLIKHQTTCTGERSYRCQECGKSFSEKSTLTQHQRTHTGEPYECHECG
KAFSFKSVLTVHQKTGEKPYECYACGNAFLRSDLIEHQRIHTREKPYECNEYGKSFSEKS
TLTKHLRTHTSEKPYECIQCGEFFCYYSSFTEHRRHTGEETFRCNECGKTFYQKSTLIVP
QR
Download sequence
Identical sequences ENSPANP00000019761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]