SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019972 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019972
Domain Number 1 Region: 83-555
Classification Level Classification E-value
Superfamily TPR-like 1.04e-24
Family HAT/Suf repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019972   Gene: ENSPANG00000023113   Transcript: ENSPANT00000021040
Sequence length 572
Comment pep:known_by_projection chromosome:PapAnu2.0:16:24888697:24932774:-1 gene:ENSPANG00000023113 transcript:ENSPANT00000021040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQY
EINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVVFCKKW
ATKTQLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECAKLYK
EEHPDYSEEILKGELARIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQTL
HTDDPLTWDYVARRELEIESQTGEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAM
WKCYITFCLERFTKKSNSGFLRGKRLERTMTSFRKAHELKLLSECQYKQLIVSLLCHKFL
REALEVAVAGTELFRDSGTMWQLKLRVLIESKSPDIAMLFEEAFVHLKPQVCLPLWISWA
EWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGYRKARAVFKSLQESRP
FSVDFFRKMIQFEKEQESCNMANIREYYEGALREFGSTDSDLWMDYMKEELNHPLGRPEN
CGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL
Download sequence
Identical sequences ENSPANP00000019972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]