SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019994 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019994
Domain Number 1 Region: 1147-1342
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 932-1055
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-32
Family Pleckstrin-homology domain (PH domain) 0.000000478
Further Details:      
 
Domain Number 3 Region: 36-159
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019994   Gene: ENSPANG00000023086   Transcript: ENSPANT00000021016
Sequence length 1961
Comment pep:known_by_projection chromosome:PapAnu2.0:9:24113520:24230618:-1 gene:ENSPANG00000023086 transcript:ENSPANT00000021016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINHNWSLLCNLYCAWSGQVSKNKDGKEQSETVSLSEDETFSWPGPKTVMLKRTSQGFGF
TLRHFIVYPPESAIQFSYKDEENGNREGKQRNRLEPMDTIFVKQVKQGGPAFEAGLCTGD
RIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDAY
LKGNEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEISPPDSSLSKQQTSTPVLTQPGR
AYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNNHAGPSHRTEEVR
YGVNEQTSLKTVSRTTSPPLSIPTTHLIHQTAGSRSLEPSGILLKSGNYSGHSDGISSSR
SQAVEAPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQST
TDYNQVVPNRTTLQGRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALT
SPSVSFSNHRTRSWDYIEGQDETLENVSSGTPIPDSNGEKKQTYKWSGFTEQDDRRGIYE
RPRQQEIHKSFRGSTFTVAPSVVNSDNRRLSGRGVGSVSQLKKIPPDLKALQSNRNFQTT
CGMSLPRGISPDRSPLVKVRSNSLKAPSTHVTKPSFSQKSFVSIKDQRPVNHLHQNSLLN
QQTWVRTDSTPNQQVETGKSPSLSGASAKPATQSSENAGTSDLELPISQRNQDLSLQEAE
IEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVH
IKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATVP
PSLTTSAPIIRRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHVSS
LKGIKITDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMY
VVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQA
EDRDDMLAWIKTIQDSSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSIR
QTLLGAKSEPKTQSPHSPKEESERKLLSKDWQSKDDTSPPKDKGTWRKGIPSIMRKTFEK
KPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQE
ELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLK
TLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHM
VTHMPDQYKIVETLIQHHDWFFTEEGADEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGV
SPGDVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDEL
DNVFFKKENVEQCHNDTKEESKKESETLGRKQKIIIAKDNSTRKDPSTTKDEKISLGKES
TPSEEPSPPYNSKHNRSPTLSCRFAILKESPRSLLAQKSSHLEETGSDSGTLLSTSSQAS
LARFSMKKSTSPETKHSEFLANISTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKGD
EADDERSELISEGRPVETDSESEFPVFPTALTSERLFRGKLQEVTKNSRRNSEGSEVSCT
EGSLTSSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKEAPSLTKVFDVM
KKGKSTGSLLTPTRGESEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKANAETAKRKS
IRRRHTLGGHRDATEISVLNFWKVHEQSGERESELSAVNRLKPKCSAQDLSISDWLARER
LRTSTSDLSRGEIGDPQTENPSTRETATTDTPLSFQCDTGSSSSTLASTNRPLLSIPPQS
SDQINGESFQNVSKNASSAANAQPRKLSETPGNKAEFHPCL
Download sequence
Identical sequences ENSPANP00000019994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]