SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020093 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020093
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily PX domain 2.22e-32
Family PX domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020093   Gene: ENSPANG00000022898   Transcript: ENSPANT00000020089
Sequence length 270
Comment pep:known_by_projection chromosome:PapAnu2.0:16:29625471:29634841:1 gene:ENSPANG00000022898 transcript:ENSPANT00000020089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRY
REFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDS
QLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKS
CCFLPRSGRRNSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLSPLSSPLCCDFGRPNEG
TSTLQSVRRAVGGDHAVPLDPGQLETVWEK
Download sequence
Identical sequences A0A096P418
ENSPANP00000020093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]