SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020455 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020455
Domain Number 1 Region: 58-218
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-44
Family RUN domain 0.000000211
Further Details:      
 
Domain Number 2 Region: 581-647
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.75e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020455   Gene: ENSPANG00000022103   Transcript: ENSPANT00000002924
Sequence length 651
Comment pep:known_by_projection chromosome:PapAnu2.0:9:61479344:61540357:1 gene:ENSPANG00000022103 transcript:ENSPANT00000002924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGDCLGLGGSRGRHGNVPPPLFRPVPAQVLRHSGRGLEVPRRPGARTGPATKDPTAVER
ANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRKSFLSYNKTI
WGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMADYLRCLIIQRDLLSEF
YEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGNKER
NVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQEEN
HQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDESQLRQDV
ENELAVQVSMKHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSEDGL
KEKNEIIARLEEKTNKITAAMRQLEQRLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQI
SQKEKQLVQLETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQIISLKKEFLNLQDENQ
QLKKIYHEQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEATHCKLCEKEFSL
SKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQRCSSNLP
Download sequence
Identical sequences ENSPANP00000020455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]