SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020489 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020489
Domain Number 1 Region: 902-1097
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000324
Further Details:      
 
Domain Number 2 Region: 690-823
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-25
Family Pleckstrin-homology domain (PH domain) 0.0000369
Further Details:      
 
Domain Number 3 Region: 19-156
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020489   Gene: ENSPANG00000022030   Transcript: ENSPANT00000003510
Sequence length 1491
Comment pep:known_by_projection chromosome:PapAnu2.0:16:45028741:45116127:1 gene:ENSPANG00000022030 transcript:ENSPANT00000003510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPRRPFPWQGPRTLLLHKSPQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRHRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSNDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEAR
SIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLCVPPAARAHP
DNSSLGMSQPRPSPGAFPHLTSEPRTPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRRA
GERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRATR
SAEALGPGALVSPRFERCGWASQRSSARTPVCPTRDLPGRQAPPPPGLQGLDDLGYIGYR
SYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPAPFPPEASEPPRAVRPEPSTRALEP
PVEDRRDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEANGRGERLGRKVAPLAATE
DSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQD
CSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSL
DSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGSGLRQWKRVYA
ALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTT
ADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPKA
DSSPKGSRGLGGLKSEFLKQSMARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKAAP
RAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRG
PGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMRTLRKL
IRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMP
DRYKIVETLIQHSDWFFSDEEDKGERTPVGDKEPQAVPNIEYLLPNIGRTVPPGDPGSDS
TTCSSAKSKGSWAPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKP
GAGATAPGAQERPQGPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDRSV
CSGASGRRAGAGDEADDERSELSHVETDTEGAAGAGPGGRLTRRPSFSSHHLMPCDTLAR
RRLARGRPDGEGASRGGPRVPEPPGSASSSSQESLRPPAAALASRPSRMEALRLRLRGTA
DDMLAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPPEPAGARAHS
DNKDSGLSSLESTKARAPSSAASLPPAPGDQGALQSQPSRRSAASRLHQCL
Download sequence
Identical sequences A0A096P565
ENSPANP00000020489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]