SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020490 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020490
Domain Number 1 Region: 886-1081
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.16e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000324
Further Details:      
 
Domain Number 2 Region: 690-811
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-26
Family Pleckstrin-homology domain (PH domain) 0.0000325
Further Details:      
 
Domain Number 3 Region: 19-156
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020490   Gene: ENSPANG00000022030   Transcript: ENSPANT00000003512
Sequence length 1477
Comment pep:known_by_projection chromosome:PapAnu2.0:16:45028741:45116127:1 gene:ENSPANG00000022030 transcript:ENSPANT00000003512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPRRPFPWQGPRTLLLHKSPQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRHRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSNDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEAR
SIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLCVPPAARAHP
DNSSLGMSQPRPSPGAFPHLTSEPRTPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRRA
GERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRATR
SAEALGPGALVSPRFERCGWASQRSSARTPVCPTRDLPGRQAPPPPGLQGLDDLGYIGYR
SYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPAPFPPEASEPPRAVRPEPSTRALEP
PVEDRRDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEANGRGERLGRKVAPLAATE
DSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQD
CSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSL
DSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGSGLRQWKRVYA
ALRARSLSLSKERREAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCEYLFQAED
RDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPKADSSPKGSRGLGG
LKSEFLKQSMARGLRTQDLPAGSKDDSAAAPKTPWGINIKKAAPRAFGVRLEECQPATEN
QRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPGDINLQDERWQDLNV
ISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMRTLRKLIRDLPGHYYETLKFLV
GHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMPDRYKIVETLIQHSDWF
FSDEEDKGERTPVGDKEPQAVPNIEYLLPNIGRTVPPGDPGSATDSTTCSSAKSKGSWAP
KKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKPGAGATAPGAQERPQ
GPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDRSVCSGASGRRAGAGDE
ADDERSELSHVETDTEGAAGAGPGGRLTRRPSFSSHHLMPCDTLARRRLARGRPDGEGAS
RGGPRVPEPPGSASSSSQESLRPPAAALASRPSRMEALRLRLRGTADDMLAVRLRRPLSP
ETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPPEPAGARAHSDNKDSGLSSLESTK
ARAPSSAASLPPAPGDQGALQSQPSRRSAASRLHQCL
Download sequence
Identical sequences ENSPANP00000020490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]