SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020493 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020493
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000111
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020493
Domain Number - Region: 938-1093
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0262
Family Phase 1 flagellin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020493   Gene: ENSPANG00000022028   Transcript: ENSPANT00000003515
Sequence length 1098
Comment pep:known_by_projection chromosome:PapAnu2.0:16:45320354:45340868:1 gene:ENSPANG00000022028 transcript:ENSPANT00000003515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVPTGPWFCRKCESQERA
ARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNKTC
YICEEQGRESKAASGACMTCNRHGCRQAFHVTCAQMAGLLCEEEVLEVDNVKYCGYCKYH
FSKMKTSRHSSGGGGGGTGGGGGSGGSMGGGGSGFISGRRSRSASPSTQQEKHPTHHERG
QKKSRKDKERLKQKHKKRPESPPSILTPPVVPTADKVSSSASSSSHHEASTQETSESSRD
SKGKKSSSHSLSHKGKKLSSGKGVSSFTSASSSSSSSSSSSGGPFQPAVSSLQSSPDFSA
FPKLEQPEEDKYSKPTAPAPSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFSTTTSSSG
RARAPSPGDYKSPHVTGSGASAGTHKRMPALSATPVPADETPETGLKEKKHKASKRSRHG
PGRPKGSRNKEGTGAPAAPSLPSAQLAGFTATAASPFSGGSLVSSGLGGLASRTFGPSGS
LPSLSLESPLLGAGIYTSNKDPISHSGGMLRAVCSTPLSSSLLGPPGTSALPRLSRSPFT
STLPSSSASISTTQVFSLAGSTFSLPSTHIFGTPMGAVNPLLAQAESSHTEPDLEDCSFR
CRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGV
NIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPG
PYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPL
PLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLN
GLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASP
QLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTAS
APPLLPAGALVAPSLGNNTSLMAAAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGADGSGG
GPKGGTADKGASVNQEKG
Download sequence
Identical sequences A0A096P568
ENSPANP00000020493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]