SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020576 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020576
Domain Number 1 Region: 147-366
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-57
Family Nuclear receptor ligand-binding domain 0.00000000117
Further Details:      
 
Domain Number 2 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020576   Gene: ENSPANG00000021701   Transcript: ENSPANT00000005362
Sequence length 416
Comment pep:known_by_projection chromosome:PapAnu2.0:16:46743920:46774713:1 gene:ENSPANG00000021701 transcript:ENSPANT00000005362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWAQAADEGERSAEFDSVQGGSGRRPAGRVTGRPPGRTAASRNACCSGSAGPAA
Download sequence
Identical sequences ENSPANP00000020576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]