SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020739 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020739
Domain Number 1 Region: 97-242
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.27e-32
Family AlaX-like 0.029
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000102
Family AlaX-M N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020739   Gene: ENSPANG00000021379   Transcript: ENSPANT00000012338
Sequence length 411
Comment pep:known_by_projection chromosome:PapAnu2.0:16:49627698:49642090:-1 gene:ENSPANG00000021379 transcript:ENSPANT00000012338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRCQRDSYAREFTTTVVSCRPAELQTEGSNGKKVLSGFHVVLEDTLLFPEGGGQPDDR
GTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLVTAVADH
LFKLKTTSWELGRFRSVIELDTPSMTTEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVE
QVRGRGLPDDHAGPVRVVSIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIFL
AGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIA
HSLRNSPDWGGVVVLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPPAS
VETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRTEVQALLQDYITTQSTKE
Download sequence
Identical sequences A0A096P5W4
ENSPANP00000020739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]