SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020741 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020741
Domain Number 1 Region: 529-601
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000314
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020741   Gene: ENSPANG00000021382   Transcript: ENSPANT00000012340
Sequence length 613
Comment pep:known_by_projection chromosome:PapAnu2.0:16:49655906:49668329:1 gene:ENSPANG00000021382 transcript:ENSPANT00000012340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVETAAEPVTVVAAVGPKAKNEEEEEEEPLPPCEAVRWAPVGAVAEAGPGATAFFEET
AAEEPGAVPGSPPDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQ
RLLRELEDFAFRGCPHVLGYEGPGDPASDEGDGLPGDRPRLRGEDQSEQEKQERLETQRE
KQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSL
STEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEVGSPLQTGGGHCE
CKAGGKTGNGCSRTGSSRPPPGDSRTKAEDVKKVRETGLHLMRRALAVLQIFAVSQFGCA
TGQIPPTLWQRGQADRDYSPLLKRLEVSVDRVKQLALRQQPHDHVITSANLQDLSLGGKD
ELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLPAFSSAPEAMHPWELFVKYY
HAKNGRAYVESPARKLSQSFALPVTGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKA
LVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVD
LAVRQLKNIKDAF
Download sequence
Identical sequences A0A096P5W6
ENSPANP00000020741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]