SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020751 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020751
Domain Number 1 Region: 222-347,452-550,665-821
Classification Level Classification E-value
Superfamily L domain-like 4e-60
Family Ngr ectodomain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 1283-1472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-44
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 892-1029
Classification Level Classification E-value
Superfamily L domain-like 4.42e-34
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 1138-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000652
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 5 Region: 1056-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000743
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 1216-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 1098-1142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1177-1214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000767
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1468-1508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00002
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020751
Domain Number - Region: 1513-1548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000178
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1557-1588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000266
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020751   Gene: ENSPANG00000021383   Transcript: ENSPANT00000013711
Sequence length 1667
Comment pep:known_by_projection chromosome:PapAnu2.0:9:88749666:88933423:-1 gene:ENSPANG00000021383 transcript:ENSPANT00000013711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGWERARGCVCDCVCVCVCVCVVCLGCVRARGLPIFLLAAVSWELEGGRGRRRRRNGR
GAERPPPKAPSLRPRTGAVAWRSKVPPNPQGRRAQARGFFGGSAPGLHLEAAPDGDGQRL
PPSGSRAGRREGTMALTPGWGSSAGPVRPELWLLLWAAAWSLGASACPALCTCTGTTVDC
HGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFVGLKQLRVLQLMENQIGAVERGAFDD
MKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKN
QINCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLS
QWLRQRPTIGLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCT
CSNGIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAE
IAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNL
SLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCA
SPRRLSNKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVICPHKCRCEASVVECS
SLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEG
AASVNELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDN
QITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQI
PLQDVAFPDFRCEEGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELY
LDGNQFTLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLA
FQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKE
PGIARCAGPLDMEGKLLLTTPAKKFECQGPPTLAVQAKCDPCLSSPCQNQGICHNDPLEV
YRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHTQEGKDAPFMCSCPTGFEGPTCGVNTD
DCVDHACANGGVCVDGVGNYTCQCPLQYEGRACEQLVDLCSPDLNPCQHEAQCVGTPDGP
RCECVPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPTP
KSPCEGTECQNGANCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPR
ANITLQVSTAEDNGILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFH
TVELVAFDQMVNLSIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNG
TGFHGCIRNLYINNELQDFTKTQMKPGVVPGCEPCLKLYCLHGICQPNATPGPMCHCEAG
WVGLHCDQPADGPCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQARALAEPCRGLQC
LHGHCQASATKGAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVE
CRGTCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA
Download sequence
Identical sequences ENSPANP00000020751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]