SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020899 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020899
Domain Number 1 Region: 936-1302
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.62e-77
Family Ankyrin repeat 0.0000125
Further Details:      
 
Domain Number 2 Region: 1321-1451
Classification Level Classification E-value
Superfamily TPR-like 2.6e-22
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 3 Region: 393-475,574-675
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000493
Family G proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020899   Gene: ENSPANG00000021044   Transcript: ENSPANT00000023359
Sequence length 2067
Comment pep:known_by_projection chromosome:PapAnu2.0:16:54812354:55283200:1 gene:ENSPANG00000021044 transcript:ENSPANT00000023359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRNSLKMLLTGGKSSRKNRSSDGGSEEPPDRRQSSVDSRQSRSGQGGISTESDCAFEPD
YAVPPLPVSEGMQHIRIMEGMSRSLPSSPLLTHQSISVRLQPVKKLTAPLRKAKFVESPR
IPESELGSPTLTSAQKLDVDAYCPGDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQ
PGDQYSMEVQDENQTSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSYGA
VTSPTSTLESRDSGIIATLTSYSENVERTKYAGESSKELGSGGSIKPWQSQKSSMDSCLY
RVDENMTASTYSLNKIPERNLETVLSQSVQSIPLYLMPRPNSVAATSSAHLEDLAYLDEQ
RHTPLRTSLRMPRQSMGGARTQQDLRVRFAPYRPPDISLKPLLFEVPSITTESVFVGRDW
VFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHGTRMRQIASDSPHASPK
HVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVAYHYCQADNAYTC
LVPEFVHNVAALLCRSPQLTAYREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENL
HKERKIPDEDFIILIDGLNEAEFHKPDYGDTIVSFLSKMIGKFPSWLKLIVTVRTSLQEI
TKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHL
KTLSQGSYLYLKLTFDLIEKGYLVLKSSSYKVVPVSLSEVYLLQCNMKFPTQSSFDRVMP
LLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSMFLIKRRDMTRMFVHPS
FREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLS
KKVGVSSSILQGLWISYSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNA
PILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGYAAAAGYLSIVVLLCKKRAKVDH
LDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGYTEI
VSYLLDLPEKDEEEVERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRR
GAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASI
ALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFYGDAEVVQFLV
DHGAMIEHVDYSGMRPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSK
LMEEGDMFYKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELKVSLLLNLSRCRRKMND
FGMAEEFATKALELKPKSYEAYYARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLL
RVEEECRQMQQPQQPPPPPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENV
SIGLQTEARPSQGLPVIQSPPSSPPPRDSAYISSSPLGSHQVFDFRSSSSVGSPTRQTYQ
STSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQYR
ASPPAESMSVYRSQSGSPVRYQQETNISQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGL
RLQPAKAQIVRSNQPSPAVHSSTVIPTGAYGQVAHSMASKYQSSQGDIGVSQSRLVYQGS
IGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGARYSQTPQIGRSQSA
SYYPVCHSKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFS
PSSNSISSTSNLTPTFRPSSSIQQMEIPLKPAYERSCDELSPVSPTQGGYPSEPTRSRTT
PFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFY
NKTNNAQNGHLLEDDYYSPHGLLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQDNL
YRQLSRDSRQGQTSPIKPKRPFVESNV
Download sequence
Identical sequences A0A096P6C4
ENSPANP00000020899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]