SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020944 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020944
Domain Number 1 Region: 133-183
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000895
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 265-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000331
Family APG12-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020944   Gene: ENSPANG00000020957   Transcript: ENSPANT00000023465
Sequence length 350
Comment pep:known_by_projection chromosome:PapAnu2.0:9:95119206:95170073:-1 gene:ENSPANG00000020957 transcript:ENSPANT00000023465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVAVVTAGSVGAAKAEVAAALPPPPPASPPALTPAPAAGEEGPAPLSETGAPGCSGSR
PPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEE
RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ
PLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKV
LESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDP
ACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
Download sequence
Identical sequences A0A096P6G9 A0A2K5NM49 A0A2K5TW06 F7DTZ0
ENSMMUP00000011638 ENSMMUP00000011638 9544.ENSMMUP00000011638 ENSPANP00000020944 NP_001181540.1.72884 XP_005566396.1.63531 XP_011907095.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]