SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333929786|ref|YP_004503365.1| from Serratia sp. AS12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333929786|ref|YP_004503365.1|
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily HAD-like 5.56e-44
Family YihX-like 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333929786|ref|YP_004503365.1|
Sequence length 196
Comment HAD-superfamily hydrolase [Serratia sp. AS12]
Sequence
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAVLSERFTLGELFQQHERGEISDEDFAEQ
LSDEMGIALSFEQFATGWQAVFVALRPEVIDIMKRLRSEGHRVVVLSNTNRLHCNYWPQH
YPEVAEAADHLYLSQDIGMRKPDANIYLHVLNAENTPPEAAVFFDDHPDNVAAAQALGIK
TVHVTDRNVVPAYFAQ
Download sequence
Identical sequences gi|333934739|ref|YP_004508317.1| gi|333929786|ref|YP_004503365.1| gi|386331609|ref|YP_006027779.1| WP_013815045.1.100617 WP_013815045.1.16783 WP_013815045.1.28294 WP_013815045.1.87098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]