SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307129350|ref|YP_003881366.1| from Dickeya dadantii 3937

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307129350|ref|YP_003881366.1|
Domain Number - Region: 111-149
Classification Level Classification E-value
Superfamily HMG-box 0.0344
Family HMG-box 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307129350|ref|YP_003881366.1|
Sequence length 158
Comment periplasmic spheroblast formation protein [Dickeya dadantii 3937]
Sequence
MSKLTAIVIASALALGSVGFSYAQDNTPPDQGAHMMKHHDGERGERGMEHDMMFKGLNLT
DEQRQKMRDIMENAKKDRERPSAETRTEWHSLIAADSFDKTKAEGVVNQMAEAGKAHMLK
RLEIQNKMYNVLTPEQKKQFNDNFAKHQKEPVPPKAAQ
Download sequence
Identical sequences E0SKU6
WP_013316289.1.88672 gi|307129350|ref|YP_003881366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]