SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307130513|ref|YP_003882529.1| from Dickeya dadantii 3937

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307130513|ref|YP_003882529.1|
Domain Number 1 Region: 213-257
Classification Level Classification E-value
Superfamily HMG-box 0.0000524
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307130513|ref|YP_003882529.1|
Sequence length 302
Comment hypothetical protein Dda3937_03599 [Dickeya dadantii 3937]
Sequence
MTEKKMQHTTFHKKLNFNKLIILDCLPENDYQTAKRLYENLSDKGFGSGICLLKVQDEKT
FRDILQDIREMFNPELNIGLQPIIHIEAHGNPLSMELPDKSTISWNDLADDFRIINKLMC
NQLITFIGTCHGYHFIYNNHTIKGFAPVCFCIAPLEAIPAGDIENSALTFYESLLSTGDL
TLSANLLDSSKFYTYNSDYMFHRAFHEATQKNHRGKTLRLRREALITEAIKIMGENWKKM
SPKDKRDYLKNARDLLDVSLKSKESLRAEFEKFSIGYMGYINEDVFEEIWKHMHHNKQGK
IY
Download sequence
Identical sequences E0SK58
gi|307130513|ref|YP_003882529.1| WP_013317433.1.88672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]