SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331703257|ref|YP_004399944.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703257|ref|YP_004399944.1|
Domain Number 1 Region: 8-120
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 0.000000000209
Family Thiamin pyrophosphokinase, catalytic domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|331703257|ref|YP_004399944.1|
Domain Number - Region: 129-204
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000366
Family Thiamin pyrophosphokinase, substrate-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331703257|ref|YP_004399944.1|
Sequence length 208
Comment hypothetical protein MLC_2370 [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MNYKTILIVTAKTNLNLERFNNESTYVIGVERGCLDLISRNMKIDYAIGDFDKVTDQELE
LIKSKIKNVEIWSPEKDYFDGELAILKGLEASKDAKIIFIANATKRYDKNYSIFHFIFKY
DLTFINDDSILFRFDKGTNILKFEDYQDYTYVSFIAKDNTKITIKDLKYECENLGLSAYS
NSCLSNAFLPYKDGIIWSNNPIICILTK
Download sequence
Identical sequences F4MPD3
gi|331703257|ref|YP_004399944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]