SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331703496|ref|YP_004400183.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703496|ref|YP_004400183.1|
Domain Number 1 Region: 153-293
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000419
Family HD domain 0.035
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000195
Family Single strand DNA-binding domain, SSB 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|331703496|ref|YP_004400183.1|
Sequence length 326
Comment CMP binding factor [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MKKVKDINIEDHLIDTILRIERVIVSTGSSGNNYLILHLADSTGRIEARKWVVSEKDKQL
LKPNTIVLLKDTIVHEYRNILQLKVEDYQVIDEKDLLKYHLNKTDLYITAPLDIKTSYLE
LISLLNSINNQTYKTITLNLIEKYKKEFLTFPAAMSIHHNVTSGLFWHSYTLVKNVLSLK
ENYFYANIDWDLLICGAILHDIGKVIEISDVNGSDYSLEGKLLGHISIGNAEINKLADKL
NLYKDQNNKINKEITLLQHMILASHGKKEFGSPIEPVLIEAVILSALDDLDAKVYKINDE
LSKVEIDNWTQKIISIDNKMFYKHKK
Download sequence
Identical sequences F4MQ22
gi|331703496|ref|YP_004400183.1| WP_013729601.1.3902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]