SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374330653|ref|YP_005080837.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374330653|ref|YP_005080837.1|
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily Phage tail protein-like 3.14e-18
Family STM4215-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374330653|ref|YP_005080837.1|
Sequence length 153
Comment hypothetical protein PSE_2305 [Pseudovibrio sp. FO-BEG1]
Sequence
MKQIEHLQDQIVERLKLYLPSVAYVGGFPSKPEEFDLANFKMSALVHYSGARYASDNDLN
HTTQSRIMRFAIALSLTSLEGEHGAYSVLERCRAALQNFPLAGASPLMLEREDLVEHAPN
IWRWQMEVRCQARSISDHQGPRRPVPPISRQKD
Download sequence
Identical sequences G8PLC3
gi|374330653|ref|YP_005080837.1| WP_014284971.1.37980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]