SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374332648|ref|YP_005082832.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374332648|ref|YP_005082832.1|
Domain Number 1 Region: 77-183
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000167
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000595
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374332648|ref|YP_005082832.1|
Sequence length 208
Comment glutathione-S-transferase domain protein [Pseudovibrio sp. FO-BEG1]
Sequence
MRARLGLVASQRAVALREIVLRDKPAHMLEISPKGTVPVLLLNDGTVIEESLDIMLWALQ
QNDPQSWLSPETGSLEEMLQLIEEMDGDFKRNLDRYKYSTRYEDADPDEHYTLAIKELSK
LSERLEKSAYLFGNRPALADQALFPFVRQFANADKERFEKEAPQSVKKWLLERIDQPDFK
TVFGKKWKPWSPEDDLVLFPEEAATHAL
Download sequence
Identical sequences G8PUU7
gi|374332648|ref|YP_005082832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]