SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374329009|ref|YP_005079193.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374329009|ref|YP_005079193.1|
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-38
Family Thioltransferase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374329009|ref|YP_005079193.1|
Sequence length 106
Comment thioredoxin [Pseudovibrio sp. FO-BEG1]
Sequence
MATVNVEDGNFEAEVLQSSTPVLVDFWATWCGPCKMIAPSLEEISEEMAGQVKIAKLDID
SNQQSAMNYGVRSIPTMILFKDGQPAATLVGAQPKGKIADWIKQYS
Download sequence
Identical sequences A0A1I7B4V9 B6R282 G8PN16
gi|374329009|ref|YP_005079193.1| WP_008548703.1.37095 WP_008548703.1.37980 WP_008548703.1.38711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]