SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374329219|ref|YP_005079403.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374329219|ref|YP_005079403.1|
Domain Number 1 Region: 158-358
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-39
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.00046
Further Details:      
 
Domain Number 2 Region: 483-589
Classification Level Classification E-value
Superfamily beta-Roll 9.42e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00069
Further Details:      
 
Domain Number 3 Region: 362-493
Classification Level Classification E-value
Superfamily beta-Roll 3.01e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0000268
Further Details:      
 
Domain Number 4 Region: 45-142
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000248
Family Collagen-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374329219|ref|YP_005079403.1|
Sequence length 601
Comment serralysin [Pseudovibrio sp. FO-BEG1]
Sequence
MSIFKLENRMTNLYETRDAADDASTSYRLRDTGQDAQGTQDNIFETVQGTISNDGDHDWY
KVELVTGQTYTFAAIGTFDGESRLVDPYLRLRDAEGNLLMEDDDGGPGAHSSITFTATTS
GTYYLDVASYGEQGTGQYGLSVVEGDKAYYDGNMGAGALLRPGLSWSGPGTPATVTYGFR
ENNNGVEDTFAHVTDAQIAAIEGVLASYSEVANISFERVNPDGFTDDATILFSNYHSTTD
GAGAYAYYPGSAEADAYEGDVWLNTNSVSTEELPTGSYSHFAVMHEVGHAVGLAHPGDYN
AGPGVRITYDDHAQFRQDTQQYSVMSYFDESNADSNLGYGGFPDTLMPLDILALQQLYGV
NTTTRADDTVYGYNSNAGGVYDFSEGMPSALTIWDAGGNDTIDMSGAGKVNQMISLIDGS
FSNVGGGLSNLAIAYNAVIENAIGSGGNDTIIGNAAGNTLTGKAGNDTLIGNGGKDKLIG
GNGHDTLRGGSGSDVLKGGAGDDTLDGGSGADKLIAGAGDDTLTGGSGSDNFCFFNVGGD
DTINDFELGNDLISIKSHMAEFANLTIFDDGGDTVITFGTNSISLVNVDAALLSESDFAF
V
Download sequence
Identical sequences G8PQH1
WP_014283718.1.37980 gi|374329219|ref|YP_005079403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]