SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374325684|ref|YP_005083884.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374325684|ref|YP_005083884.1|
Domain Number - Region: 5-54
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0302
Family ADP-ribosylating toxins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374325684|ref|YP_005083884.1|
Sequence length 73
Comment hypothetical protein P186_0171 [Pyrobaculum sp. 1860]
Sequence
MEELAKYFEDLDEARRIRRERADWSFIHSLPPRQRAALQYYIETGDLYIASRIAGMSMEE
FNELRRRAKIPST
Download sequence
Identical sequences G7VEK8
gi|374325684|ref|YP_005083884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]