SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374327174|ref|YP_005085374.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374327174|ref|YP_005085374.1|
Domain Number 1 Region: 11-82
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000024
Family Tropomyosin 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|374327174|ref|YP_005085374.1|
Domain Number - Region: 115-150
Classification Level Classification E-value
Superfamily EF-hand 0.0224
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374327174|ref|YP_005085374.1|
Sequence length 193
Comment hypothetical protein P186_1708 [Pyrobaculum sp. 1860]
Sequence
MLGGALYWLGKKFQEIEMRFREIEMRFKEIDRRFEEINKRFESIERRFEGIEKRFEAVDA
RFAEMDKKFVAFADSIRSAVVAMNSAVVEFLGVKGLISPREASFLVSEISRLSLAIKANP
ISKEEVEYIRQVFAKGDVDKISVEELERVAEIAKRWWYEDGSEVAYKLFLYTWMLRAYKL
YGKESQESGAGRS
Download sequence
Identical sequences G7VGM2
gi|374327174|ref|YP_005085374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]