SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374327252|ref|YP_005085452.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374327252|ref|YP_005085452.1|
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily SirA-like 3.53e-16
Family SirA-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374327252|ref|YP_005085452.1|
Sequence length 77
Comment SirA family protein [Pyrobaculum sp. 1860]
Sequence
MEVVKKSIKISGSHCLGPVELRKAIADVPVGGYLEVITNDPCAKEDIPVWCKFTKNELVE
YTELEGGWMRFLIKRTR
Download sequence
Identical sequences G7VH29
gi|374327252|ref|YP_005085452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]