SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374327616|ref|YP_005085816.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374327616|ref|YP_005085816.1|
Domain Number 1 Region: 57-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000733
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374327616|ref|YP_005085816.1|
Sequence length 111
Comment hypothetical protein P186_2172 [Pyrobaculum sp. 1860]
Sequence
MGFFPKAMENQLCFACTEQRYAKPTTRVRCSVCKKEVSWRHVVSHYAEHGKKSGNDVVCP
ICNNKVKSQEYRRHVRMHFVAKSEPGYMCGICGRGFVTLRSLLVHLLKTHE
Download sequence
Identical sequences G7VB67
gi|374327616|ref|YP_005085816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]