SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374327731|ref|YP_005085931.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374327731|ref|YP_005085931.1|
Domain Number 1 Region: 55-147
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.68e-17
Family FHA domain 0.00073
Further Details:      
 
Weak hits

Sequence:  gi|374327731|ref|YP_005085931.1|
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0033
Family Ran binding protein zinc finger-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374327731|ref|YP_005085931.1|
Sequence length 151
Comment hypothetical protein P186_2287 [Pyrobaculum sp. 1860]
Sequence
MTWRCPVCGTENRDDELMCRVCGAYKPEATTRKISQVVKEAVSAVVAVEILESPIETLVG
RRFEFKAGSPGAVVTVGRAVENNVVVPDPAVSRRHLRLIVTSNGIVVEDLGSSNGTYLIE
GEKERQIKVENVGGGALVRIGNTKLKVSLSR
Download sequence
Identical sequences G7VBR2
gi|374327731|ref|YP_005085931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]