SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330506425|ref|YP_004382853.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330506425|ref|YP_004382853.1|
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.93e-26
Family TM1367-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330506425|ref|YP_004382853.1|
Sequence length 119
Comment hypothetical protein MCON_0126 [Methanosaeta concilii GP6]
Sequence
MKAIIIEVYGKGSALAEMDERNPIIREAIWQALPIEGRAILWGEEVYFDLDMKLKDENPS
ASSEAGDICYWSPGPALCIFFGQTQPYSRVNHIGKVVQGLDLFERINAADRIVLRKKEL
Download sequence
Identical sequences F4BUG0
gi|330506425|ref|YP_004382853.1| WP_013718097.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]