SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330506955|ref|YP_004383383.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330506955|ref|YP_004383383.1|
Domain Number 1 Region: 278-558
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.4e-141
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000026
Further Details:      
 
Domain Number 2 Region: 4-277
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.1e-139
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330506955|ref|YP_004383383.1|
Sequence length 559
Comment methyl-coenzyme M reductase subunit alpha [Methanosaeta concilii GP6]
Sequence
MAVKHTKKLFVKALNKKFGKDFDLASQKVEYKRLGPEQNARKREFMEYAKKLEGKRGMTG
YNPYVHAGGIPLGQRQLVPYKLSSTEYVVEGDDLHFVNNPAMQQFWDDIRRTIVVGLDMA
HEVLQKRLGKEVTPETINNYLEILNHAMPGAAVVQEHMVETHPGLVDDCNVRVFSGDDAL
ADEIDDQYKIDINKMFPEDQAETLKAAIGKTTWQAIHVPTIVVRTCDGGTTSRWSAMQLC
MTFIDAYNMCAGEAAVADLAYAAKHAAVLQMSDMLPARRARGPNNPGGISFGFMSDMVQT
SRVKPQDPVYVSLNVVAAGSMFYDQIWLGSYMSGGVGFTQYATAAYTNDVLDDFSYYGVD
YANDKFGGFAKAPATIDVAKELATEVTLYGIEQYEAFPTLLEDHFGGSQRAAVLAAASGI
TSAIATGHSQIGLAGWYLSMLLHKEAWGRLGFFGYDLQDQCGPTNVFSYQSDEGNPLELR
GANYPNYAMNVGHQGEYAGITSAAHAGRMDAFAVNPLIKVTFANPGLVFDFANVRDCFGK
GGAREFRAAGERSLVMPAV
Download sequence
Identical sequences F4BXY1
gi|330506955|ref|YP_004383383.1| WP_013718622.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]