SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330506958|ref|YP_004383386.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330506958|ref|YP_004383386.1|
Domain Number 1 Region: 186-433
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.05e-124
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000613
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.37e-71
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330506958|ref|YP_004383386.1|
Sequence length 434
Comment methyl-coenzyme M reductase subunit beta [Methanosaeta concilii GP6]
Sequence
MSDKIDLYSDRGVLLKSDVDLSAVSPLKNAAMQRLISLTKRTVAVNLAGVEGALKTGKVA
GGRRQIKGRELNYDVVANAGALAEKIKTLLQVAPGDDTNVQILGGGKQLLVQVPTARVNA
ASEFVVGLTGAASATVEALIQQFKVGIVEAPMVHASVWGEYPQTVGMNGGNVASVLNIPQ
NDEGLGFALRNVMANHLAMITKRNAMNAAALASIYEQIGEMEMGNAMGIFERHQLLGMAY
QGLNANNMVYETVKANGKTGTIGTVVQSIVGKALEDKVIKAGKKLPSGYVMYEANDVSKW
NAYAAAGVLAATMVNCGSLRGAQAVSSTLLYFNDIIEKETALPGCDFGRVMGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVAAAVALDAGTQMFTPEMTSGLVGAIYGEI
KEFREPIVSVAEAV
Download sequence
Identical sequences A0A0W8FBP9 A0A1V4V8N4 F4BXY4
gi|330506958|ref|YP_004383386.1| WP_013718625.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]